Modulation by LL-37 of the responses of salivary glands to purinergic agonists.
نویسندگان
چکیده
The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A(2) (PLA(2)). The small release of ATP induced by LL-37 could not account for this stimulation because apyrase did not significantly block the response to LL-37. The divalent cation magnesium inhibited the response to LL-37, but this inhibition was probably nonspecific because it also inhibited the in vitro bacteriostatic effect of the peptide. The increase of calcium uptake by LL-37 was not affected by 1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenylpiperazine (KN-62), a rather specific inhibitor of P2X(7) receptors in mice. LL-37 also increased [Ca(2+)](i) in cells from mice invalidated for these receptors. LL-37 had no effect on the response to carbachol. It inhibited the increase of [Ca(2+)](i) and the activation of phospholipase D by ATP. It potentiated the activation of the PLA(2) by the nucleotide. Finally, LL-37 increased the fluidity of the plasma membrane of submandibular gland cells. In conclusion, our results suggest that LL-37 is an autocrine regulator of submandibular gland cells. It does not stimulate mouse P2X(7) receptors but modulates their responses.
منابع مشابه
Improved quantification of salivary gland scintigraphy by means of factor analysis
Introduction: In this study the automatic separation of oral and salivary gland activity and spontaneous secretion by means of factor analysis for quantitative salivary gland scintigraphy is introduced. Methods: After intravenous administration of 99mTc sodium pertechnetate, dynamic scintigraphy was performed. 20 minutes after tracer application 2 ml of lemon juice was delivered to stimulate t...
متن کاملRadioprotective effect of thymol against salivary glands dysfunction induced by ionizing radiation in rats
The aim of this study was to investigate the radioprotective effect of thymol as a natural product against salivary glands dysfunction induced by ionizing radiation in rats. The rats were treated with thymol at dose of 50 mg/Kg before exposure to radiation at dose 15Gy. Salivary gland function was evaluated with radioisotope scintigraphy and then salivary gland to background counts ratio was ca...
متن کاملRadioprotective effect of thymol against salivary glands dysfunction induced by ionizing radiation in rats
The aim of this study was to investigate the radioprotective effect of thymol as a natural product against salivary glands dysfunction induced by ionizing radiation in rats. The rats were treated with thymol at dose of 50 mg/Kg before exposure to radiation at dose 15Gy. Salivary gland function was evaluated with radioisotope scintigraphy and then salivary gland to background counts ratio was ca...
متن کاملQuantification of Partial Volume Effects in Salivary Glands SPECT Images after Radiation Therapy of Head and Neck Tumors
Introduction: Radical radiation therapy of head and neck cancers may injure the salivary glands and reduce their function. Single-photon emission computed tomography (SPECT) images maybe used to evaluate function post-therapy. However, accurate quantification is hindered by the partial volume effects (PVEs). The present study involved the introduction of a PVEs quantif...
متن کاملModulation of the TLR-mediated inflammatory response by the endogenous human host defense peptide LL-37.
The sole human cathelicidin peptide, LL-37, has been demonstrated to protect animals against endotoxemia/sepsis. Low, physiological concentrations of LL-37 (< or =1 microg/ml) were able to modulate inflammatory responses by inhibiting the release of the proinflammatory cytokine TNF-alpha in LPS-stimulated human monocytic cells. Microarray studies established a temporal transcriptional profile a...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
عنوان ژورنال:
- Molecular pharmacology
دوره 69 6 شماره
صفحات -
تاریخ انتشار 2006